PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013608729.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 270aa    MW: 30608.5 Da    PI: 8.3935
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013608729.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-073175446
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     WT+eE +++ +a + +  +   +W ++a++++ g+t  ++   + k
   XP_013608729.1 31 WTKEENKKFERALAIYADDtpdRWFKVAAMIP-GKTISDVMTQYSK 75
                     *****************99*************.****999888866 PP

2Myb_DNA-binding409e-13130174347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
   XP_013608729.1 130 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVGSKTPTQVASHAQKY 174
                      8****************************999************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.9362679IPR017884SANT domain
SMARTSM007178.9E-72779IPR001005SANT/Myb domain
SuperFamilySSF466891.58E-102983IPR009057Homeodomain-like
CDDcd001673.01E-73176No hitNo description
PfamPF002493.2E-63175IPR001005SANT/Myb domain
PROSITE profilePS5129418.108123179IPR017930Myb domain
SuperFamilySSF466891.0E-15125178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-16127178IPR006447Myb domain, plants
SMARTSM007179.9E-11127177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-11127179IPR009057Homeodomain-like
CDDcd001676.75E-10130174No hitNo description
PfamPF002493.8E-10130174IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
METLHPLLSH VPTSDHRFVV QEMMCLQTSI WTKEENKKFE RALAIYADDT PDRWFKVAAM  60
IPGKTISDVM TQYSKLEEDL FDIEAGLIPI PGYPSAGFDQ LVSPYDHDLY RKRPSGGARG  120
FDQDRRKGVP WTEEEHRRFL LGLLKYGKGD WRNISRNFVG SKTPTQVASH AQKYYQRQLS  180
GAKDKRRPSI HDITTVNLLN TNITRPSSDH DRFLQQPDES KLGFTDKGNA EEGVMFLGQN  240
LSSVLSPYEP AFKFTGTNVY GGGAYGLARS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-1631971177RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAPTransfer from AT5G05790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892010.0AC189201.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB005N03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608729.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_013728477.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-72DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078EDH40.0A0A078EDH4_BRANA; BnaC09g49710D protein
TrEMBLA0A0D3EHJ50.0A0A0D3EHJ5_BRAOL; Uncharacterized protein
STRINGBra009134.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.11e-163MYB family protein